Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial Angiotensinogen protein

This Bacterial Angiotensinogen protein spans the amino acid sequence from region 1-183aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PPT N-acetyltransferase, Phosphinothricin-resistance protein

UniProt

Q57146

Expression Region

1-183aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Streptomyces viridochromogenes

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 1-183aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSPERRPVEIRPATAADMAAVCDIVNHYIETSTVNFRTEPQTPQEWIDDLERLQDRYPWLVAEVEGVVAGIAYAGPWKARNAYDWTVESTVYVSHRHQRLGLGSTLYTHLLKSMEAQGFKSVVAVIGLPNDPSVRLHEALGYTARGTLRAAGYKHGGWHDVGFWQRDFELPAPPRPVRPVTQI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMB8 Antibody
orb680570 100 µL

PSMB8 Antibody

Sign In for Pricing
View Details
PROTAC BCR-ABL1 ligand 1
T13832-01 100 mg

PROTAC BCR-ABL1 ligand 1

Sign In for Pricing
View Details
PROTAC BCR-ABL1 ligand 1
T13832-02 500 mg

PROTAC BCR-ABL1 ligand 1

Sign In for Pricing
View Details
Telethonin (TCAP) (NM_003673) Human Tagged ORF Clone
RC203158 10 µg

Telethonin (TCAP) (NM_003673) Human Tagged ORF Clone

Sign In for Pricing
View Details
3- (2-furylmethyl) -2-mercapto-5,6,7,8-tetrahydro[1]benzothieno[2,3-d]pyrimidin-4 (3H) -one
sc-344168A 5 g

3- (2-furylmethyl) -2-mercapto-5,6,7,8-tetrahydro[1]benzothieno[2,3-d]pyrimidin-4 (3H) -one

Sign In for Pricing
View Details
4-Bromo-N- (2-bromo-ethyl) -benzenesulfonamide
sc-336370 1 g

4-Bromo-N- (2-bromo-ethyl) -benzenesulfonamide

Sign In for Pricing
View Details