Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RBM14 protein

This Human RBM14 protein spans the amino acid sequence from region 1-669aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Paraspeckle protein 2 Short name, PSP2 RNA-binding motif protein 14 RRM-containing coactivator activator/modulator Synaptotagmin-interacting protein Short name, SYT-interacting protein

UniProt

Q96PK6

Expression Region

1-669aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

85.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 1-669aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKIFVGNVDGADTTPEELAALFAPYGTVMSCAVMKQFAFVHMRENAGALRAIEALHGHELRPGRALVVEMSRPRPLNTWKIFVGNVSAACTSQELRSLFERRGRVIECDVVKDYAFVHMEKEADAKAAIAQLNGKEVKGKRINVELSTKGQKKGPGLAVQSGDKTKKPGAGDTAFPGTGGFSATFDYQQAFGNSTGGFDGQARQPTPPFFGRDRSPLRRSPPRASYVAPLTAQPATYRAQPSVSLGAAYRAQPSASLGVGYRTQPMTAQAASYRAQPSVSLGAPYRGQLASPSSQSAAASSLGPYGGAQPSASALSSYGGQAAAASSLNSYGAQGSSLASYGNQPSSYGAQAASSYGVRAAASSYNTQGAASSLGSYGAQAASYGAQSAASSLAYGAQAASYNAQPSASYNAQSAPYAAQQAASYSSQPAAYVAQPATAAAYASQPAAYAAQATTPMAGSYGAQPVVQTQLNSYGAQASMGLSGSYGAQSAAAATGSYGAAAAYGAQPSATLAAPYRTQSSASLAASYAAQQHPQAAASYRGQPGNAYDGAGQPSAAYLSMSQGAVANANSTPPPYERTRLSPPRASYDDPYKKAVAMSKRYGSDRRLAELSDYRRLSESQLSFRRSPTKSSLDYRRLPDAHSDYARYSGSYNDYLRAAQMHSGYQRRM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Green Fluorescent FAM-Leu-DAP Serine Protease Assay Kit
967 25 Tests

Green Fluorescent FAM-Leu-DAP Serine Protease Assay Kit

Sign In for Pricing
View Details
CD66, pan (CEA) (Cocktail), CF640R conjugate, 0.1mg/mL
BNC401139-500 1x 500 µL

CD66, pan (CEA) (Cocktail), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human TMPRSS11A activation kit by CRISPRa
GA117451 1 Kit

Human TMPRSS11A activation kit by CRISPRa

Sign In for Pricing
View Details
Ataxin 1 (ATXN1) (NM_000332) Human Over-expression Lysate
LY424789 100 µg

Ataxin 1 (ATXN1) (NM_000332) Human Over-expression Lysate

Sign In for Pricing
View Details
CD44 Mouse Monoclonal Antibody [Clone ID: OX-49]
CL110F 100 µg

CD44 Mouse Monoclonal Antibody [Clone ID: OX-49]

Sign In for Pricing
View Details
Recombinant Mouse CXADR/CAR Protein (His Tag)
PKSM040910 100 µg

Recombinant Mouse CXADR/CAR Protein (His Tag)

Sign In for Pricing
View Details