E. coli ISPU protein
This E. coli ISPU protein spans the amino acid sequence from region 1-253aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Ditrans, polycis-undecaprenylcistransferase Undecaprenyl diphosphate synthase Short name, UDS Undecaprenyl pyrophosphate synthase Short name, UPP synthase
UniProt
P60472
Expression Region
1-253aa
Tag
N-terminal 6xHis-tagged
Source
E.coli
Origin
Escherichia coli (strain K12)
Field of Research
Infectious Disease & Virology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
32.4 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Tag Info: N-terminal 6xHis-taggedExpression Region: 1-253aaSequence Info: Partial
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MMLSATQPLSEKLPAHGCRHVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFSSENWNRPAQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRERRFGGTEPGDETA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
396502-01 50 µL
CD44 (CD44 Antigen, CDw44, Epican, Extracellular Matrix Receptor III, ECMR-III, GP90 Lymphocyte Homing/Adhesion Receptor, HUTCH-I, Heparan Sulfate Proteoglycan, Hermes Antigen, Hyaluronate Receptor, Phagocytic glycoprotein 1, PGP-1, Phagocytic Glycoprotein I, PGP-I, LHR, MDU2, MDU3, MIC4)
Sign In for Pricing
View Details 396502-02 100 µL
CD44 (CD44 Antigen, CDw44, Epican, Extracellular Matrix Receptor III, ECMR-III, GP90 Lymphocyte Homing/Adhesion Receptor, HUTCH-I, Heparan Sulfate Proteoglycan, Hermes Antigen, Hyaluronate Receptor, Phagocytic glycoprotein 1, PGP-1, Phagocytic Glycoprotein I, PGP-I, LHR, MDU2, MDU3, MIC4)
Sign In for Pricing
View Details 