Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli ISPU protein

This E. coli ISPU protein spans the amino acid sequence from region 1-253aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ditrans, polycis-undecaprenylcistransferase Undecaprenyl diphosphate synthase Short name, UDS Undecaprenyl pyrophosphate synthase Short name, UPP synthase

UniProt

P60472

Expression Region

1-253aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 1-253aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MMLSATQPLSEKLPAHGCRHVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFSSENWNRPAQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRERRFGGTEPGDETA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 7 (Biotin)
MBS6242717-01 0.1 mL

Cytokeratin 7 (Biotin)

Sign In for Pricing
View Details
Cytokeratin 7 (Biotin)
MBS6242717-02 5x 0.1 mL

Cytokeratin 7 (Biotin)

Sign In for Pricing
View Details
Recombinant Rat Tektin-2 (Tekt2)
MBS1344737-01 0.02 mg (E-Coli)

Recombinant Rat Tektin-2 (Tekt2)

Sign In for Pricing
View Details
Recombinant Rat Tektin-2 (Tekt2)
MBS1344737-02 0.02 mg (Yeast)

Recombinant Rat Tektin-2 (Tekt2)

Sign In for Pricing
View Details
Recombinant Rat Tektin-2 (Tekt2)
MBS1344737-03 0.1 mg (E-Coli)

Recombinant Rat Tektin-2 (Tekt2)

Sign In for Pricing
View Details
Recombinant Rat Tektin-2 (Tekt2)
MBS1344737-04 0.1 mg (Yeast)

Recombinant Rat Tektin-2 (Tekt2)

Sign In for Pricing
View Details