Human SLURP1 protein
This Human SLURP1 protein spans the amino acid sequence from region 23-103aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
ARS component B ARS (component B) -81/S Anti-neoplastic urinary protein Short name, ANUP
UniProt
P55000
Expression Region
23-103aa
Tag
N-terminal 6xHis-tagged
Source
Yeast
Origin
Homo sapiens (Human)
Field of Research
Cardiovascular Research
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
10.9 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Tag Info: N-terminal 6xHis-taggedExpression Region: 23-103aaSequence Info: Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
LKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Cd5 Rat Monoclonal Antibody [Clone ID: 53-7.3]](https://cdn.genprice.uk/products/937/68dd189d061270361e8fd14c/imageurl/am31857bt-n.webp)
BNC470960-100 1x 100 µL
MUC1 / EMA / CD227 (Epithelial Marker) (rMUC1/960), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![AHA1 (AHSA1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D2]](https://cdn.genprice.uk/products/937/68dd1b81061270361ea1e909/imageurl/ta808924am.webp)
TA808924AM 100 µL
AHA1 (AHSA1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D2]
Sign In for Pricing
View Details ![p16INK4A (CDKN2A) Mouse Monoclonal Antibody [Clone ID: OTI10F12]](https://cdn.genprice.uk/products/937/68dd18ba061270361e90870d/imageurl/cf809883.webp)
CF809883 100 µg
p16INK4A (CDKN2A) Mouse Monoclonal Antibody [Clone ID: OTI10F12]
Sign In for Pricing
View Details 
E-EL-M0634-01 24 Tests
Mouse PCSK9 (Proprotein Convertase Subtilisin/Kexin Type 9) ELISA Kit
Sign In for Pricing
View Details