Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SLURP1 protein

This Human SLURP1 protein spans the amino acid sequence from region 23-103aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ARS component B ARS (component B) -81/S Anti-neoplastic urinary protein Short name, ANUP

UniProt

P55000

Expression Region

23-103aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

10.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 23-103aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Faropenem Sodium Salt Hemipentahydrate
TRC-F103300-5MG 5 mg

Faropenem Sodium Salt Hemipentahydrate

Sign In for Pricing
View Details
PAPP-A / Pappalysin-1 (Marker of Atherosclerosis and Aneuploid Fetus) (PAPPA/2717), CF405S conjugate, 0.1mg/mL
BNC042717-100 1x 100 µL

PAPP-A / Pappalysin-1 (Marker of Atherosclerosis and Aneuploid Fetus) (PAPPA/2717), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Rab4 Antibody
RC-16663-01 50 μL

Recombinant Rab4 Antibody

Sign In for Pricing
View Details
Recombinant Rab4 Antibody
RC-16663-02 100 µL

Recombinant Rab4 Antibody

Sign In for Pricing
View Details
Recombinant Rab4 Antibody
RC-16663-03 1 mL

Recombinant Rab4 Antibody

Sign In for Pricing
View Details
L-(2S,3aS,7aS)-Octahydro-1H-indole-2-carboxylic Acid Benzyl Ester Tosylate Salt
TRC-O236910-250MG 250 mg

L-(2S,3aS,7aS)-Octahydro-1H-indole-2-carboxylic Acid Benzyl Ester Tosylate Salt

Sign In for Pricing
View Details