Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial HLGB protein

This Bacterial HLGB protein spans the amino acid sequence from region 26-325aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

H-gamma-1 H-gamma-I

UniProt

P0A075

Expression Region

26-325aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Staphylococcus aureus (strain N315)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

50.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 26-325aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AEGKITPVSVKKVDDKVTLYKTTATADSDKFKISQILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPNDYDFSKLYWGAKYNVSISSQSNDSVNVVDYAPKNQNEEFQVQNTLGYTFGGDISISNGLSGGLNGNTAFSETINYKQESYRTTLSRNTNYKNVGWGVEAHKIMNNGWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIAQHQMPLLSRSNFNPEFLSVLSHRQDGAKKSKITVTYQREMDLYQIRWNGFYWAGANYKNFKTRTFKSTYEIDWENHKVKLLDTKETENNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

p63 (TP63) Human Gene Knockout Kit (CRISPR)
KN208013RB 1 Kit

p63 (TP63) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse BK (Bradykinin) ELISA Kit
E-EL-M0202-01 24 Tests

Mouse BK (Bradykinin) ELISA Kit

Sign In for Pricing
View Details
Mouse BK (Bradykinin) ELISA Kit
E-EL-M0202-02 48 Tests

Mouse BK (Bradykinin) ELISA Kit

Sign In for Pricing
View Details
Mouse BK (Bradykinin) ELISA Kit
E-EL-M0202-03 96 Tests

Mouse BK (Bradykinin) ELISA Kit

Sign In for Pricing
View Details
2-Pentanone
TRC-P274020-250G 250 g

2-Pentanone

Sign In for Pricing
View Details
Rspo1 Mouse Gene Knockout Kit (CRISPR)
KN515169 1 Kit

Rspo1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details