Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial HLGB protein

This Bacterial HLGB protein spans the amino acid sequence from region 26-325aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

H-gamma-1 H-gamma-I

UniProt

P0A075

Expression Region

26-325aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Staphylococcus aureus (strain N315)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

50.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 26-325aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AEGKITPVSVKKVDDKVTLYKTTATADSDKFKISQILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPNDYDFSKLYWGAKYNVSISSQSNDSVNVVDYAPKNQNEEFQVQNTLGYTFGGDISISNGLSGGLNGNTAFSETINYKQESYRTTLSRNTNYKNVGWGVEAHKIMNNGWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIAQHQMPLLSRSNFNPEFLSVLSHRQDGAKKSKITVTYQREMDLYQIRWNGFYWAGANYKNFKTRTFKSTYEIDWENHKVKLLDTKETENNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

p15 INK4b (CDKN2B) Human Gene Knockout Kit (CRISPR)
KN204895 1 Kit

p15 INK4b (CDKN2B) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Protein Lysate, Skin
CP565438 150 µg

Tissue Protein Lysate, Skin

Sign In for Pricing
View Details
TCF19 (NM_001077511) Human Over-expression Lysate
LY421454 100 µg

TCF19 (NM_001077511) Human Over-expression Lysate

Sign In for Pricing
View Details
FITC Conjugated Aegopodium podagraria Lectin (Ground Elder) -APP-
F-8003-1 1 mg

FITC Conjugated Aegopodium podagraria Lectin (Ground Elder) -APP-

Sign In for Pricing
View Details
OR5H6 Human Gene Knockout Kit (CRISPR)
KN419714 1 Kit

OR5H6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GPR83 Mouse Monoclonal Antibody [Clone ID: OTI6C6]
CF811749 100 µg

GPR83 Mouse Monoclonal Antibody [Clone ID: OTI6C6]

Sign In for Pricing
View Details