Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse CBS protein

This Mouse CBS protein spans the amino acid sequence from region 2-561aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-thionase Serine sulfhydrase

UniProt

Q91WT9

Expression Region

2-561aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

65.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 2-561aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PSGTSQCEDGSAGGFQHLDMHSEKRQLEKGPSGDKDRVWIRPDTPSRCTWQLGRAMADSPHYHTVLTKSPKILPDILRKIGNTPMVRINKISKNAGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERAGNLKPGDTIIEPTSGNTGIGLALAAAVKGYRCIIVMPEKMSMEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDDTAEEILQQCDGKLDMLVASAGTGGTITGIARKLKEKCPGCKIIGVDPEGSILAEPEELNQTEQTAYEVEGIGYDFIPTVLDRAVVDKWFKSNDEDSFAFARMLIAQEGLLCGGSSGSAMAVAVKAARELQEGQRCVVILPDSVRNYMSKFLSDKWMLQKGFMKEELSVKRPWWWRLRVQELSLSAPLTVLPTVTCEDTIAILREKGFDQAPVVNESGAILGMVTLGNMLSSLLAGKVRPSDEVCKVLYKQFKPIHLTDTLGTLSHILEMDHFALVVHEQIQSRDQAWSGVVGGPTDCSNGMSSKQQMVFGVVTAIDLLNFVAAREQTQT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PNKD Antibody, HRP conjugated
CSB-PA843154LB01HU-01 50 µg

PNKD Antibody, HRP conjugated

Sign In for Pricing
View Details
PNKD Antibody, HRP conjugated
CSB-PA843154LB01HU-02 100 µg

PNKD Antibody, HRP conjugated

Sign In for Pricing
View Details
BBS7 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2543655 100 µL

BBS7 Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
Neurofascin Rabbit Polyclonal Antibody (BF750)
orb2558942 100 µL

Neurofascin Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
HDAC3 (Histone Deacetylase 3, HD3, RPD3-2, SMAP45, RPD3) (MaxLight 750) discontinued
127763-ML750 100 µL

HDAC3 (Histone Deacetylase 3, HD3, RPD3-2, SMAP45, RPD3) (MaxLight 750) discontinued

Sign In for Pricing
View Details
ASF1B
A3780-60 100 µL

ASF1B

Sign In for Pricing
View Details