Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse CBS protein

This Mouse CBS protein spans the amino acid sequence from region 2-561aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-thionase Serine sulfhydrase

UniProt

Q91WT9

Expression Region

2-561aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

65.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 2-561aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PSGTSQCEDGSAGGFQHLDMHSEKRQLEKGPSGDKDRVWIRPDTPSRCTWQLGRAMADSPHYHTVLTKSPKILPDILRKIGNTPMVRINKISKNAGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERAGNLKPGDTIIEPTSGNTGIGLALAAAVKGYRCIIVMPEKMSMEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDDTAEEILQQCDGKLDMLVASAGTGGTITGIARKLKEKCPGCKIIGVDPEGSILAEPEELNQTEQTAYEVEGIGYDFIPTVLDRAVVDKWFKSNDEDSFAFARMLIAQEGLLCGGSSGSAMAVAVKAARELQEGQRCVVILPDSVRNYMSKFLSDKWMLQKGFMKEELSVKRPWWWRLRVQELSLSAPLTVLPTVTCEDTIAILREKGFDQAPVVNESGAILGMVTLGNMLSSLLAGKVRPSDEVCKVLYKQFKPIHLTDTLGTLSHILEMDHFALVVHEQIQSRDQAWSGVVGGPTDCSNGMSSKQQMVFGVVTAIDLLNFVAAREQTQT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Rad21 Rabbit Monoclonal Antibody
M01864-3-40μl 40 µL

Anti-Rad21 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Human CD265 ELISA Kit
MBS825045-01 96 Tests

Human CD265 ELISA Kit

Sign In for Pricing
View Details
Human CD265 ELISA Kit
MBS825045-02 5x 96 Tests

Human CD265 ELISA Kit

Sign In for Pricing
View Details
GPR78, ID (GPR78, G-protein coupled receptor 78) (MaxLight 650)
MBS6304027-01 0.1 mL

GPR78, ID (GPR78, G-protein coupled receptor 78) (MaxLight 650)

Sign In for Pricing
View Details
GPR78, ID (GPR78, G-protein coupled receptor 78) (MaxLight 650)
MBS6304027-02 5x 0.1 mL

GPR78, ID (GPR78, G-protein coupled receptor 78) (MaxLight 650)

Sign In for Pricing
View Details
Seglitide acetate
T28743-01 1 mg

Seglitide acetate

Sign In for Pricing
View Details