Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial PAL protein

This Bacterial PAL protein spans the amino acid sequence from region 22-176aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

19KDA surface antigen PPL

UniProt

P26493

Expression Region

22-176aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Legionella pneumophila

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 22-176aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CSKTPGSADGGAAVGDGDATAQGLGQMTHFAGQEPGESYTTQAPHNQLYLFAYDDSTLASKYLPSVNAQAEYLKTHPGARVMIAGHTDERGSREYNVALGERRADTVAEILRMAGVSRQQIRVVSYGKERPANYGHDEASHAQNRRVEFIYEATR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Leukemia Inhibitory Factor Receptor ELISA Kit
MBS042751-01 48 Well

Monkey Leukemia Inhibitory Factor Receptor ELISA Kit

Sign In for Pricing
View Details
Monkey Leukemia Inhibitory Factor Receptor ELISA Kit
MBS042751-02 96 Well

Monkey Leukemia Inhibitory Factor Receptor ELISA Kit

Sign In for Pricing
View Details
Monkey Leukemia Inhibitory Factor Receptor ELISA Kit
MBS042751-03 5x 96 Well

Monkey Leukemia Inhibitory Factor Receptor ELISA Kit

Sign In for Pricing
View Details
Monkey Leukemia Inhibitory Factor Receptor ELISA Kit
MBS042751-04 10x 96 Well

Monkey Leukemia Inhibitory Factor Receptor ELISA Kit

Sign In for Pricing
View Details
ELISA Kit for Enhancer Of Zeste Homolog 2 (EZH2)
TRV-0004260-01 24 Tests

ELISA Kit for Enhancer Of Zeste Homolog 2 (EZH2)

Sign In for Pricing
View Details
ELISA Kit for Enhancer Of Zeste Homolog 2 (EZH2)
TRV-0004260-02 48 Tests

ELISA Kit for Enhancer Of Zeste Homolog 2 (EZH2)

Sign In for Pricing
View Details