Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GDI2 protein

This Human GDI2 protein spans the amino acid sequence from region 1-445aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Guanosine diphosphate dissociation inhibitor 2 , GDI-2

UniProt

P50395

Expression Region

1-445aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 1-445aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGIDPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCYETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNIYKRMTGSEFDFEEMKRKKNDIYGED

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tcf3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6140407 1.0 µg DNA

Tcf3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
TXNL1P1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV788872 1.0 µg DNA

TXNL1P1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
NQO1 (A180)
sc-32793 200 µg/mL

NQO1 (A180)

Sign In for Pricing
View Details
Human NOX5 (NM_001184780) AAV Particle
RC230463A1V 250 µL

Human NOX5 (NM_001184780) AAV Particle

Sign In for Pricing
View Details
MLTK (Mitogen-activated Protein Kinase Kinase Kinase MLT, Human Cervical Cancer Suppressor Gene 4 Protein, HCCS4, HCCS-4, Leucine Zipper- and Sterile alpha Motif-containing Kinase, MLK-like Mitogen-activated Protein Triple Kinase, Mixed Lineage Kinase-related Kinase, MLK-related Kinase, MRK, Sterile alpha Motif- and Leucine Zipper-containing Kinase AZK, ZAK) (Biotin)
135497-Biotin 100 µL

MLTK (Mitogen-activated Protein Kinase Kinase Kinase MLT, Human Cervical Cancer Suppressor Gene 4 Protein, HCCS4, HCCS-4, Leucine Zipper- and Sterile alpha Motif-containing Kinase, MLK-like Mitogen-activated Protein Triple Kinase, Mixed Lineage Kinase-related Kinase, MLK-related Kinase, MRK, Sterile alpha Motif- and Leucine Zipper-containing Kinase AZK, ZAK) (Biotin)

Sign In for Pricing
View Details
Camel Aminoacylase 1 ELISA Kit
MBS107471-01 48 Well

Camel Aminoacylase 1 ELISA Kit

Sign In for Pricing
View Details