Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GDI2 protein

This Human GDI2 protein spans the amino acid sequence from region 1-445aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Guanosine diphosphate dissociation inhibitor 2 , GDI-2

UniProt

P50395

Expression Region

1-445aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 1-445aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGIDPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCYETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNIYKRMTGSEFDFEEMKRKKNDIYGED

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human FGF9
orb1099772-01 50 µg

Recombinant Human FGF9

Sign In for Pricing
View Details
Recombinant Human FGF9
orb1099772-02 100 µg

Recombinant Human FGF9

Sign In for Pricing
View Details
Recombinant Human FGF9
orb1099772-03 200 µg

Recombinant Human FGF9

Sign In for Pricing
View Details
Recombinant Human FGF9
orb1099772-04 1 mg

Recombinant Human FGF9

Sign In for Pricing
View Details
Regenerating Islet Derived Protein 3 Alpha (REG3a) BioAssayTM ELISA Kit (Mouse)
027827 96 Tests

Regenerating Islet Derived Protein 3 Alpha (REG3a) BioAssayTM ELISA Kit (Mouse)

Sign In for Pricing
View Details
Anti-PRPF4 Antibody Picoband®, Dylight550 Conjugate
A08225-2-Dylight550 100 µg

Anti-PRPF4 Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details