Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Primate DEFB126 protein

This Primate DEFB126 protein spans the amino acid sequence from region 21-63aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Defensin, beta 126

UniProt

A4H244

Expression Region

21-63aa

Tag

N-terminal GST-tagged

Source

Yeast

Origin

Pongo pygmaeus (Bornean orangutan)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal GST-taggedExpression Region: 21-63aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SWYVKKCLNDVGICKKKCKPEELHVKNGWAMCGKQRDCCVPAD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Galaxolide-d6 (Mixture of Diastereomers) (>80%)
TRC-G189002-5MG 5 mg

Galaxolide-d6 (Mixture of Diastereomers) (>80%)

Sign In for Pricing
View Details
Pholcodine N-Oxide
TRC-P351510-25MG 25 mg

Pholcodine N-Oxide

Sign In for Pricing
View Details
Recombinant Ki67 Monoclonal Antibody
AN301074L-01 50 µL

Recombinant Ki67 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Ki67 Monoclonal Antibody
AN301074L-02 100 µL

Recombinant Ki67 Monoclonal Antibody

Sign In for Pricing
View Details
AGPAT7 (LPCAT4) (NM_153613) Human Recombinant Protein
TP310488L 1 mg

AGPAT7 (LPCAT4) (NM_153613) Human Recombinant Protein

Sign In for Pricing
View Details
BOB.1 (B-Cell Marker) (BOB1/2422), CF594 conjugate, 0.1mg/mL
BNC942422-100 1x 100 µL

BOB.1 (B-Cell Marker) (BOB1/2422), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details