Primate DEFB126 protein
This Primate DEFB126 protein spans the amino acid sequence from region 21-63aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Defensin, beta 126
UniProt
A4H244
Expression Region
21-63aa
Tag
N-terminal GST-tagged
Source
Yeast
Origin
Pongo pygmaeus (Bornean orangutan)
Field of Research
Immunology & Inflammation
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
31.9 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Tag Info: N-terminal GST-taggedExpression Region: 21-63aaSequence Info: Partial
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
SWYVKKCLNDVGICKKKCKPEELHVKNGWAMCGKQRDCCVPAD
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![ADH1B Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3F2]](https://cdn.genprice.uk/products/937/68dd1b6a061270361ea16046/imageurl/ta502920am.webp)
TA502920AM 100 µL
ADH1B Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3F2]
Sign In for Pricing
View Details ![Cardiac Troponin T (TNNT2) Mouse Monoclonal Antibody [Clone ID: OTI3C6]](https://cdn.genprice.uk/products/937/68dd18b9061270361e90820b/imageurl/cf807957.webp)
CF807957 100 µg
Cardiac Troponin T (TNNT2) Mouse Monoclonal Antibody [Clone ID: OTI3C6]
Sign In for Pricing
View Details 
BNC742123-500 1x 500 µL
Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2123R), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details