What is the catalog number for Yeast CYS4 protein?

The catalog number for Yeast CYS4 protein is orb418784.

What sizes are available for Yeast CYS4 protein?

Yeast CYS4 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Yeast CYS4 protein come in?

Yeast CYS4 protein is available in 3 different pack sizes.

Is Yeast CYS4 protein in stock?

Yeast CYS4 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Yeast CYS4 protein

This Yeast CYS4 protein spans the amino acid sequence from region 1-345aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-thionase, Serine sulfhydrase, Sulfur transfer protein 4

UniProt

P32582

Expression Region

1-345aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 1-345aaSequence Info: Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTKSEQQADSRHNVIDLVGNTPLIALKKLPKALGIKPQIYAKLELYNPGGSIKDRIAKSMVEEAEASGRIHPSRSTLIEPTSGNTGIGLALIGAIKGYRTIITLPEKMSNEKVSVLKALGAEIIRTPTAAAWDSPESHIGVAKKLEKEIPGAVILDQYNNMMNPEAHYFGTGREIQRQLEDLNLFDNLRAVVAGAGTGGTISGISKYLKEQNDKIQIVGADPFGSILAQPENLNKTDITDYKVEGIGYDFVPQVLDRKLIDVWYKTDDKPSFKYARQLISNEGVLVGGSSGSAFTAVVKYCEDHPELTEDDVIVAIFPDSIRSYLTKFVDDEWLKKNNLWDDDVL