Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat RB1 protein

This Rat RB1 protein spans the amino acid sequence from region 721-919aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PRb , Rbpp105

UniProt

P33568

Expression Region

721-919aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 721-919aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KDLPHAAQETFKRVLIREEEFDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPRSPYKFSSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGGNPPKPLKKLRFDIEGSDEADGSKHLPAESKFQQKLAEMTSTRTRMQKQKLNDSMEISNKEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Ublcp1 shRNA (UAS) - Lentiviral mouseUblcp1 shRNA (UAS, GFP) (25)
GTR15254348 1 Vial

Lentiviral mouse Ublcp1 shRNA (UAS) - Lentiviral mouseUblcp1 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Anti-Human PTH Monoclonal Antibody (1A677)
HF921015-01 50 µg

Anti-Human PTH Monoclonal Antibody (1A677)

Sign In for Pricing
View Details
Anti-Human PTH Monoclonal Antibody (1A677)
HF921015-02 100 µg

Anti-Human PTH Monoclonal Antibody (1A677)

Sign In for Pricing
View Details
MTSS1L Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
31110066 1.0 µg DNA

MTSS1L Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O6:H1 (strain CFT073/700928/UPEC) TORZ Polyclonal Antibody
MBS9001754 Inquire

Rabbit anti-Escherichia coli O6:H1 (strain CFT073/700928/UPEC) TORZ Polyclonal Antibody

Sign In for Pricing
View Details
Human ITGb1 ELISA Kit (Ready to Use)
orb551141-01 48 Tests

Human ITGb1 ELISA Kit (Ready to Use)

Sign In for Pricing
View Details