Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IGF1R protein

This Human IGF1R protein spans the amino acid sequence from region 763-931aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Insulin-like growth factor I receptor , IGF-I receptor, CD221

UniProt

P08069

Expression Region

763-931aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 763-931aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPVFFYVQAKTGYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNFSF10 Antibody
KC-8166-01 50 μL

TNFSF10 Antibody

Sign In for Pricing
View Details
TNFSF10 Antibody
KC-8166-02 100 µL

TNFSF10 Antibody

Sign In for Pricing
View Details
TNFSF10 Antibody
KC-8166-03 1 mL

TNFSF10 Antibody

Sign In for Pricing
View Details
C3orf36 Human Gene Knockout Kit (CRISPR)
KN424374 1 Kit

C3orf36 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HSP27 (Heat Shock Protein 27) (rHSPB1/774), 0.2mg/mL
BNUB2308-500 1x 500 µL

HSP27 (Heat Shock Protein 27) (rHSPB1/774), 0.2mg/mL

Sign In for Pricing
View Details
Colloidal Gold Conjugated Glycine max Lectin (Soybean) -SBA-,  5nm
GP-1301-5 1 mL

Colloidal Gold Conjugated Glycine max Lectin (Soybean) -SBA-, 5nm

Sign In for Pricing
View Details