Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HLA-G protein

This Human HLA-G protein spans the amino acid sequence from region 25-338aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HLA G antigen, MHC class I antigen G

UniProt

P17693

Expression Region

25-338aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 25-338aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXP3 (FXP3/197), 1mg/mL
BNUM0197-50 1x 50 µL

FOXP3 (FXP3/197), 1mg/mL

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/1620), CF405S conjugate, 0.1mg/mL
BNC041620-500 1x 500 µL

CD10 (Membrane Metalloendopeptidase) (MME/1620), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MCM6 (Proliferation Marker) (MCM6/3000), 0.2mg/mL
BNUB3000-100 1x 100 µL

MCM6 (Proliferation Marker) (MCM6/3000), 0.2mg/mL

Sign In for Pricing
View Details
CDC42SE2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI11F7]
TA808229AM 100 µL

CDC42SE2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI11F7]

Sign In for Pricing
View Details
Tissue Total RNA, Colon
CR561556 5 µg

Tissue Total RNA, Colon

Sign In for Pricing
View Details
Recombinant Rat CD157/BST1 Protein (His Tag)
PKSR030207 100 µg

Recombinant Rat CD157/BST1 Protein (His Tag)

Sign In for Pricing
View Details