Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HLA-G protein

This Human HLA-G protein spans the amino acid sequence from region 25-338aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HLA G antigen, MHC class I antigen G

UniProt

P17693

Expression Region

25-338aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 25-338aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NUDT12 activation kit by CRISPRa
GA113207 1 Kit

Human NUDT12 activation kit by CRISPRa

Sign In for Pricing
View Details
CD5 Human Gene Knockout Kit (CRISPR)
KN206494RB 1 Kit

CD5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Almorexant Hydrochloride
TRC-A575190-5MG 5 mg

Almorexant Hydrochloride

Sign In for Pricing
View Details
RNF220 Antibody
KC-30295-01 50 μL

RNF220 Antibody

Sign In for Pricing
View Details
RNF220 Antibody
KC-30295-02 100 µL

RNF220 Antibody

Sign In for Pricing
View Details
RNF220 Antibody
KC-30295-03 1 mL

RNF220 Antibody

Sign In for Pricing
View Details