Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HLA-G protein

This Human HLA-G protein spans the amino acid sequence from region 25-338aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HLA G antigen, MHC class I antigen G

UniProt

P17693

Expression Region

25-338aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 25-338aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Iso-Forskolin
TRC-F701803-5MG 5 mg

Iso-Forskolin

Sign In for Pricing
View Details
Annexin A11 (ANXA11) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C6]
TA500950BM 100 µL

Annexin A11 (ANXA11) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C6]

Sign In for Pricing
View Details
Colloidal Gold Conjugated Allomyrina dichotoma Lectin (Japanese Beetle) -Allo A-,  40nm
GP-6401-40 1 mL

Colloidal Gold Conjugated Allomyrina dichotoma Lectin (Japanese Beetle) -Allo A-, 40nm

Sign In for Pricing
View Details
RAD26L (ERCC6L2) (NM_001010895) Human Over-expression Lysate
LY423215 100 µg

RAD26L (ERCC6L2) (NM_001010895) Human Over-expression Lysate

Sign In for Pricing
View Details
ATP5PD (Center) Rabbit Polyclonal Antibody
AP50301PU-N 400 µL

ATP5PD (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Osteopontin Antibody
8C0284-AAT 50 µg

Osteopontin Antibody

Sign In for Pricing
View Details