Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Monkey LTB protein

This Monkey LTB protein spans the amino acid sequence from region 49-244aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tumor necrosis factor C , TNF-CTumor necrosis factor ligand superfamily member 3

UniProt

Q862Z7

Expression Region

49-244aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Pan troglodytes (Chimpanzee)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 49-244aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QDQGGLVTETADPGAQAQQGLGFQKLPEEEPETDLSPGLPAAHLIGAPLKGQGLGWETTKEQAFLTSGTQFSDAEGLALPQDGLYYLYCLVGYRGRTPPGGGDPQGRSVTLRSSLYRAGGAYGPGTPELLLEGAETVTPVLDPARRQGYGPLWYTSVGFGGLVQLRRGERVYVNISHPDMVDFARGKTFFGAVMVG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wilms Tumor Protein (WT1) (NM_024426) Human Mutant ORF Clone
RC403494 10 µg

Wilms Tumor Protein (WT1) (NM_024426) Human Mutant ORF Clone

Sign In for Pricing
View Details
Human Tumor Necrosis Factor Ligand Superfamily Member 13B (TNFSF13B) Protein
abx658346-01 10 µg

Human Tumor Necrosis Factor Ligand Superfamily Member 13B (TNFSF13B) Protein

Sign In for Pricing
View Details
Human Tumor Necrosis Factor Ligand Superfamily Member 13B (TNFSF13B) Protein
abx658346-02 50 µg

Human Tumor Necrosis Factor Ligand Superfamily Member 13B (TNFSF13B) Protein

Sign In for Pricing
View Details
Human Tumor Necrosis Factor Ligand Superfamily Member 13B (TNFSF13B) Protein
abx658346-03 100 µg

Human Tumor Necrosis Factor Ligand Superfamily Member 13B (TNFSF13B) Protein

Sign In for Pricing
View Details
Human Tumor Necrosis Factor Ligand Superfamily Member 13B (TNFSF13B) Protein
abx658346-04 200 µg

Human Tumor Necrosis Factor Ligand Superfamily Member 13B (TNFSF13B) Protein

Sign In for Pricing
View Details
Human Tumor Necrosis Factor Ligand Superfamily Member 13B (TNFSF13B) Protein
abx658346-05 500 µg

Human Tumor Necrosis Factor Ligand Superfamily Member 13B (TNFSF13B) Protein

Sign In for Pricing
View Details