Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Monkey LTB protein

This Monkey LTB protein spans the amino acid sequence from region 49-244aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tumor necrosis factor C , TNF-CTumor necrosis factor ligand superfamily member 3

UniProt

Q862Z7

Expression Region

49-244aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Pan troglodytes (Chimpanzee)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 49-244aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QDQGGLVTETADPGAQAQQGLGFQKLPEEEPETDLSPGLPAAHLIGAPLKGQGLGWETTKEQAFLTSGTQFSDAEGLALPQDGLYYLYCLVGYRGRTPPGGGDPQGRSVTLRSSLYRAGGAYGPGTPELLLEGAETVTPVLDPARRQGYGPLWYTSVGFGGLVQLRRGERVYVNISHPDMVDFARGKTFFGAVMVG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPM1M Peptide - middle region
MBS3235890-01 0.1 mg

PPM1M Peptide - middle region

Sign In for Pricing
View Details
PPM1M Peptide - middle region
MBS3235890-02 5x 0.1 mg

PPM1M Peptide - middle region

Sign In for Pricing
View Details
Platelet And Endothelial Cell Adhesion Molecule 1 (CD31) Antibody (PE)
abx228484-01 20 Tests

Platelet And Endothelial Cell Adhesion Molecule 1 (CD31) Antibody (PE)

Sign In for Pricing
View Details
Platelet And Endothelial Cell Adhesion Molecule 1 (CD31) Antibody (PE)
abx228484-02 100 Tests

Platelet And Endothelial Cell Adhesion Molecule 1 (CD31) Antibody (PE)

Sign In for Pricing
View Details
Platelet And Endothelial Cell Adhesion Molecule 1 (CD31) Antibody (PE)
abx228484-03 200 Tests

Platelet And Endothelial Cell Adhesion Molecule 1 (CD31) Antibody (PE)

Sign In for Pricing
View Details
YWHAG (Tyrosine 3-Monooxygenase/Tryptophan 5-Monooxygenase Activation Protein, gamma Polypeptide, 14-3-3GAMMA) (APC)
MBS6451829-01 0.1 mL

YWHAG (Tyrosine 3-Monooxygenase/Tryptophan 5-Monooxygenase Activation Protein, gamma Polypeptide, 14-3-3GAMMA) (APC)

Sign In for Pricing
View Details