Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast ATG8 protein

This Yeast ATG8 protein spans the amino acid sequence from region 1-116aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Autophagy-related ubiquitin-like modifier ATG8

UniProt

Q6FXR8

Expression Region

1-116aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 1-116aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKSSFKSEYPFEKRKAESERISEKFQNRIPVICEKAEKSDIPEVDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTASLMSQVYQEHKDKDGFLYVTYSGENTFG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DOP1B Antibody
KC-42768-01 50 μL

DOP1B Antibody

Sign In for Pricing
View Details
DOP1B Antibody
KC-42768-02 100 µL

DOP1B Antibody

Sign In for Pricing
View Details
DOP1B Antibody
KC-42768-03 1 mL

DOP1B Antibody

Sign In for Pricing
View Details
Cell Meter™ Phosphatidylserine Apoptosis Assay Kit *Green Fluorescence Optimized for Microplate Readers*
22791-AAT 100 Tests

Cell Meter™ Phosphatidylserine Apoptosis Assay Kit *Green Fluorescence Optimized for Microplate Readers*

Sign In for Pricing
View Details
1H,1H,2H,2H-Tridecafluoro-1-n-octanol
TRC-T774750-5G 5 g

1H,1H,2H,2H-Tridecafluoro-1-n-octanol

Sign In for Pricing
View Details
Tyrosinase (T311 + OCA1/812), CF405S conjugate, 0.1mg/mL
BNC040908-100 1x 100 µL

Tyrosinase (T311 + OCA1/812), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details