Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dog NPC2 protein

This Dog NPC2 protein spans the amino acid sequence from region 22-149aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Niemann Pick type C2 protein homologcE1

UniProt

Q28895

Expression Region

22-149aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Canis lupus familiaris (Dog) (Canis familiaris)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 22-149aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VHFKDCGSAVGVIKELNVNPCPAQPCKLHKGQSYSVNVTFTSNIPSQSSKAVVHGIVLGVAVPFPIPEADGCKSGINCPIQKDKTYSYLNKLPVKNEYPSIKLVVQWMLLGDNNQHLFCWEIPVQIEG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LPAR3 (EDG7, Edg-7, LPA Receptor 3, HOFNH30, LPA3, RP4-678I3, LP-A3, LPA Receptor EDG7, LPA-3)
170915 50 µg

LPAR3 (EDG7, Edg-7, LPA Receptor 3, HOFNH30, LPA3, RP4-678I3, LP-A3, LPA Receptor EDG7, LPA-3)

Sign In for Pricing
View Details
TUBGCP2 (NM_001256618) Human Tagged ORF Clone
RG234866 10 µg

TUBGCP2 (NM_001256618) Human Tagged ORF Clone

Sign In for Pricing
View Details
ERMN CRISPRa sgRNA lentivector (set of three targets)(Rat)
19436126 3x 1.0µg DNA

ERMN CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
GPR83 Polyclonal Antibody
CAC13476-01 50 µg

GPR83 Polyclonal Antibody

Sign In for Pricing
View Details
GPR83 Polyclonal Antibody
CAC13476-02 100 µg

GPR83 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal U2AF2 Antibody
NBP2-58989-25ul 25 µL

Rabbit Polyclonal U2AF2 Antibody

Sign In for Pricing
View Details