Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dog NPC2 protein

This Dog NPC2 protein spans the amino acid sequence from region 22-149aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Niemann Pick type C2 protein homologcE1

UniProt

Q28895

Expression Region

22-149aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Canis lupus familiaris (Dog) (Canis familiaris)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 22-149aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VHFKDCGSAVGVIKELNVNPCPAQPCKLHKGQSYSVNVTFTSNIPSQSSKAVVHGIVLGVAVPFPIPEADGCKSGINCPIQKDKTYSYLNKLPVKNEYPSIKLVVQWMLLGDNNQHLFCWEIPVQIEG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CACNA2D3 Protein Vector (Mouse) (pPM-C-HA)
14892024 500 ng

CACNA2D3 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Sodium phenylbutyrate 50mg
A16714-50 50 mg

Sodium phenylbutyrate 50mg

Sign In for Pricing
View Details
Antxrl sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3885804 1.0 µg DNA

Antxrl sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
EVL Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV664649 1.0 µg DNA

EVL Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Recombinant Newcastle disease virus Fusion glycoprotein F0 (F), partial
MBS1170524-01 0.02 mg (Baculovirus)

Recombinant Newcastle disease virus Fusion glycoprotein F0 (F), partial

Sign In for Pricing
View Details
Recombinant Newcastle disease virus Fusion glycoprotein F0 (F), partial
MBS1170524-02 0.1 mg (Baculovirus)

Recombinant Newcastle disease virus Fusion glycoprotein F0 (F), partial

Sign In for Pricing
View Details