Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TEAD4 protein

This Human TEAD4 protein spans the amino acid sequence from region 74-434aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TEA domain family member 4 , TEAD-4Transcription factor 13-like 1Transcription factor RTEF-1

UniProt

Q15561

Expression Region

74-434aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

56.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 74-434aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQAAKDKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fluorescein diacetate
BIF4105-01 5 g

Fluorescein diacetate

Sign In for Pricing
View Details
Fluorescein diacetate
BIF4105-02 25 g

Fluorescein diacetate

Sign In for Pricing
View Details
Fluorescein diacetate
BIF4105-03 50 g

Fluorescein diacetate

Sign In for Pricing
View Details
Fluorescein diacetate
BIF4105-04 100 g

Fluorescein diacetate

Sign In for Pricing
View Details
DEM1, ID (DEM1, C1orf176, Probable exonuclease V, Defects in morphology protein 1 homolog) (MaxLight 750)
MBS6291682-01 0.1 mL

DEM1, ID (DEM1, C1orf176, Probable exonuclease V, Defects in morphology protein 1 homolog) (MaxLight 750)

Sign In for Pricing
View Details
DEM1, ID (DEM1, C1orf176, Probable exonuclease V, Defects in morphology protein 1 homolog) (MaxLight 750)
MBS6291682-02 5x 0.1 mL

DEM1, ID (DEM1, C1orf176, Probable exonuclease V, Defects in morphology protein 1 homolog) (MaxLight 750)

Sign In for Pricing
View Details