Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli NIKR protein

This E. coli NIKR protein spans the amino acid sequence from region 1-133aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NikR, yhhG, b3481, JW3446Nickel-responsive regulator

UniProt

P0A6Z6

Expression Region

1-133aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 1-133aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MQRVTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRSALAQEATQQHGTQGFAVLSYVYEHEKRDLASRIVSTQHHHHDLSVATLHVHINHDDCLEIAVLKGDMGDVQHFADDVIAQRGVRHGHLQCLPKED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Akr1c13 shRNA (UAS) - Lentiviral mouse Akr1c13 shRNA (UAS, RFP) (100)
GTR15190872 1 Vial

Lentiviral mouse Akr1c13 shRNA (UAS) - Lentiviral mouse Akr1c13 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Mouse Lcn5 Pre-designed siRNA Set A
SI107464A 1 Each

Mouse Lcn5 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Aquaporin 2 Antibody: PerCP
MBS805432-01 0.1 mg

Aquaporin 2 Antibody: PerCP

Sign In for Pricing
View Details
Aquaporin 2 Antibody: PerCP
MBS805432-02 5x 0.1 mg

Aquaporin 2 Antibody: PerCP

Sign In for Pricing
View Details
Postsynaptic Density Protein 95 (PSD95) Antibody
abx225147-01 50 µL

Postsynaptic Density Protein 95 (PSD95) Antibody

Sign In for Pricing
View Details
Postsynaptic Density Protein 95 (PSD95) Antibody
abx225147-02 100 µL

Postsynaptic Density Protein 95 (PSD95) Antibody

Sign In for Pricing
View Details