Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial RBTD protein

This Bacterial RBTD protein spans the amino acid sequence from region 1-249aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RbtD, Ribitol 2-dehydrogenase, RDH, EC 1.1.1.56

UniProt

P00335

Expression Region

1-249aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Enterobacter aerogenes (Aerobacter aerogenes)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 1-249aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKHSVSSMNTSLSGKVAAITGAASGIGLECARTLLGAGAKVVLIDREGEKLNKLVAELGENAFALQVDLMQADQVDNLLQGILQLTGRLDIFHANAGAYIGGPVAEGDPDVWDRVLHLNINAAFRCVRSVLPHLIAQKSGDIIFTAVIAGVVPVIWEPVYTASKFAVQAFVHTTRRQVAQYGVRVGAVLPGPVVTALLDDWPKAKMDEALANGSLMQPIEVAESVLFMVTRSKNVTVRDIVILPNSVDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR62, NT (GPR62, Probable G-protein coupled receptor 62, G-protein coupled receptor GPCR8, G-protein coupled receptor KPG_005) (MaxLight 750)
MBS6303973-01 0.1 mL

GPR62, NT (GPR62, Probable G-protein coupled receptor 62, G-protein coupled receptor GPCR8, G-protein coupled receptor KPG_005) (MaxLight 750)

Sign In for Pricing
View Details
GPR62, NT (GPR62, Probable G-protein coupled receptor 62, G-protein coupled receptor GPCR8, G-protein coupled receptor KPG_005) (MaxLight 750)
MBS6303973-02 5x 0.1 mL

GPR62, NT (GPR62, Probable G-protein coupled receptor 62, G-protein coupled receptor GPCR8, G-protein coupled receptor KPG_005) (MaxLight 750)

Sign In for Pricing
View Details
Recombinant Gamma-Glutamyltransferase 1 (gGT1)
TRV-0014740-01 10 µg

Recombinant Gamma-Glutamyltransferase 1 (gGT1)

Sign In for Pricing
View Details
Recombinant Gamma-Glutamyltransferase 1 (gGT1)
TRV-0014740-02 50 µg

Recombinant Gamma-Glutamyltransferase 1 (gGT1)

Sign In for Pricing
View Details
Recombinant Gamma-Glutamyltransferase 1 (gGT1)
TRV-0014740-03 100 µg

Recombinant Gamma-Glutamyltransferase 1 (gGT1)

Sign In for Pricing
View Details
Recombinant Gamma-Glutamyltransferase 1 (gGT1)
TRV-0014740-04 200 µg

Recombinant Gamma-Glutamyltransferase 1 (gGT1)

Sign In for Pricing
View Details