Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial TETX protein

This Bacterial TETX protein spans the amino acid sequence from region 123-573aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tentoxylysin

UniProt

P04958

Expression Region

123-573aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Clostridium tetani (strain Massachusetts / E88)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

55.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 123-573aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SLLDKFDTNSNSVSFNLLEQDPSGATTKSAMLTNLIIFGPGPVLNKNEVRGIVLRVDNKNYFPCRDGFGSIMQMAFCPEYVPTFDNVIENITSLTIGKSKYFQDPALLLMHELIHVLHGLYGMQVSSHEIIPSKQEIYMQHTYPISAEELFTFGGQDANLISIDIKNDLYEKTLNDYKAIANKLSQVTSCNDPNIDIDSYKQIYQQKYQFDKDSNGQYIVNEDKFQILYNSIMYGFTEIELGKKFNIKTRLSYFSMNHDPVKIPNLLDDTIYNDTEGFNIESKDLKSEYKGQNMRVNTNAFRNVDGSGLVSKLIGLCKKIIPPTNIRENLYNRTASLTDLGGELCIKIKNEDLTFIAEKNSFSEEPFQDEIVSYNTKNKPLNFNYSLDKIIVDYNLQSKITLPNDRTTPVTKGIPYAPEYKSNAASTIEIHNIDDNTIYQYLYAQKSPTTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hexyl Octyl Phthalate
TRC-B185420-50MG 50 mg

Hexyl Octyl Phthalate

Sign In for Pricing
View Details
TNF Antibody
KC-371-01 50 μL

TNF Antibody

Sign In for Pricing
View Details
TNF Antibody
KC-371-02 100 µL

TNF Antibody

Sign In for Pricing
View Details
TNF Antibody
KC-371-03 1 mL

TNF Antibody

Sign In for Pricing
View Details
PHYHIPL (NM_032439) Human Recombinant Protein
TP303950 20 µg

PHYHIPL (NM_032439) Human Recombinant Protein

Sign In for Pricing
View Details
Pyridinium Chlorochromate
TRC-P991820-100G 100 g

Pyridinium Chlorochromate

Sign In for Pricing
View Details