Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial TETX protein

This Bacterial TETX protein spans the amino acid sequence from region 123-573aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tentoxylysin

UniProt

P04958

Expression Region

123-573aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Clostridium tetani (strain Massachusetts / E88)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

55.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 123-573aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SLLDKFDTNSNSVSFNLLEQDPSGATTKSAMLTNLIIFGPGPVLNKNEVRGIVLRVDNKNYFPCRDGFGSIMQMAFCPEYVPTFDNVIENITSLTIGKSKYFQDPALLLMHELIHVLHGLYGMQVSSHEIIPSKQEIYMQHTYPISAEELFTFGGQDANLISIDIKNDLYEKTLNDYKAIANKLSQVTSCNDPNIDIDSYKQIYQQKYQFDKDSNGQYIVNEDKFQILYNSIMYGFTEIELGKKFNIKTRLSYFSMNHDPVKIPNLLDDTIYNDTEGFNIESKDLKSEYKGQNMRVNTNAFRNVDGSGLVSKLIGLCKKIIPPTNIRENLYNRTASLTDLGGELCIKIKNEDLTFIAEKNSFSEEPFQDEIVSYNTKNKPLNFNYSLDKIIVDYNLQSKITLPNDRTTPVTKGIPYAPEYKSNAASTIEIHNIDDNTIYQYLYAQKSPTTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRIA1 pSer836 Rabbit Polyclonal Antibody
AP26044PU-S 50 µL

GRIA1 pSer836 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
L-Aspartic Anhydride Hydrochloride
TRC-A788780-5G 5 g

L-Aspartic Anhydride Hydrochloride

Sign In for Pricing
View Details
Human Cholecystokinin 8, Octapeptide (CCK8) ELISA Kit
RD-CCK8-Hu-01 96 Tests

Human Cholecystokinin 8, Octapeptide (CCK8) ELISA Kit

Sign In for Pricing
View Details
Human Cholecystokinin 8, Octapeptide (CCK8) ELISA Kit
RD-CCK8-Hu-02 48 Tests

Human Cholecystokinin 8, Octapeptide (CCK8) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human Tau-D Protein (His Tag)
PKSH032757-01 10 µg

Recombinant Human Tau-D Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Tau-D Protein (His Tag)
PKSH032757-02 50 µg

Recombinant Human Tau-D Protein (His Tag)

Sign In for Pricing
View Details