Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli GLSA1 protein

This E. coli GLSA1 protein spans the amino acid sequence from region 1-310aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GlsA1, ybaS, b0485, JW0474Glutaminase 1, EC 3.5.1.2

UniProt

P77454

Expression Region

1-310aa

Tag

N-terminal 6xHis-GST-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

62.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-GST-taggedExpression Region: 1-310aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLDANKLQQAVDQAYTQFHSLNGGQNADYIPFLANVPGQLAAVAIVTCDGNVYSAGDSDYRFALESISKVCTLALALEDVGPQAVQDKIGADPTGLPFNSVIALELHGGKPLSPLVNAGAIATTSLINAENVEQRWQRILHIQQQLAGEQVALSDEVNQSEQTTNFHNRAIAWLLYSAGYLYCDAMEACDVYTRQCSTLLNTIELATLGATLAAGGVNPLTHKRVLQADNVPYILAEMMMEGLYGRSGDWAYRVGLPGKSGVGGGILAVVPGVMGIAAFSPPLDEDGNSVRGQKMVASVAKQLGYNVFKG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Diaph2 Antibody - C-terminal region : Biotin (ARP61724_P050-Biotin)
ARP61724_P050-Biotin 100 µL

Diaph2 Antibody - C-terminal region : Biotin (ARP61724_P050-Biotin)

Sign In for Pricing
View Details
ADRA2B Protein Vector (Human) (pPM-C-HA)
PV061371 500 ng

ADRA2B Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
RPS18 Polyclonal Antibody, HRP Conjugated
A51758-100 100 µL

RPS18 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Recombinant Rhesus Macaque AKT3 Protein, His (Fc)-Avi-tagged
AKT3-126R 50 µg

Recombinant Rhesus Macaque AKT3 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
SLC25A24 Adenovirus (Human)
44006051 1.0 mL

SLC25A24 Adenovirus (Human)

Sign In for Pricing
View Details
Fe65 CRISPR/Cas9 KO Plasmid (h)
sc-403226 20 µg

Fe65 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details