Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TGFB2 protein

This Human TGFB2 protein spans the amino acid sequence from region 304-413aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BSC-1 cell growth inhibitorCetermin, Glioblastoma-derived T-cell suppressor factor , G-TSFPolyergin

UniProt

P61812

Expression Region

304-413aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 304-413aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SGSM2 Rabbit Polyclonal Antibody (Cy5.5)
orb1076615 100 µL

SGSM2 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
CSPS (SULT1A3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6A8]
TA811317BM 100 µL

CSPS (SULT1A3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6A8]

Sign In for Pricing
View Details
CMTM2 Polyclonal Antibody
E44H04346 100 µL

CMTM2 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant BVDV E (rns) /gp44/48 Protein, N-His
AP98102 50 µg

Recombinant BVDV E (rns) /gp44/48 Protein, N-His

Sign In for Pricing
View Details
Rabbit Polyclonal Hydroxyacid Oxidase-1/HAO-1 Antibody [Biotin]
NBP2-99928B 0.1 mL

Rabbit Polyclonal Hydroxyacid Oxidase-1/HAO-1 Antibody [Biotin]

Sign In for Pricing
View Details
Rabbit Glutamate Decarboxylase 1 (GAD1) ELISA Kit
abx362502 96 Well

Rabbit Glutamate Decarboxylase 1 (GAD1) ELISA Kit

Sign In for Pricing
View Details