Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TGFB2 protein

This Human TGFB2 protein spans the amino acid sequence from region 304-413aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BSC-1 cell growth inhibitorCetermin, Glioblastoma-derived T-cell suppressor factor , G-TSFPolyergin

UniProt

P61812

Expression Region

304-413aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 304-413aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AZ31 25mg
A16813-25 25 mg

AZ31 25mg

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to Cytokeratin 19
sAP-0232 50 µg

Mouse Monoclonal Antibody to Cytokeratin 19

Sign In for Pricing
View Details
(1S,5S) -3-Oxabicyclo[3.1.0]hexan-1-amine hydrochloride
OR1032285-01 50 mg

(1S,5S) -3-Oxabicyclo[3.1.0]hexan-1-amine hydrochloride

Sign In for Pricing
View Details
(1S,5S) -3-Oxabicyclo[3.1.0]hexan-1-amine hydrochloride
OR1032285-02 100 mg

(1S,5S) -3-Oxabicyclo[3.1.0]hexan-1-amine hydrochloride

Sign In for Pricing
View Details
(1S,5S) -3-Oxabicyclo[3.1.0]hexan-1-amine hydrochloride
OR1032285-03 250 mg

(1S,5S) -3-Oxabicyclo[3.1.0]hexan-1-amine hydrochloride

Sign In for Pricing
View Details
(1S,5S) -3-Oxabicyclo[3.1.0]hexan-1-amine hydrochloride
OR1032285-04 1 g

(1S,5S) -3-Oxabicyclo[3.1.0]hexan-1-amine hydrochloride

Sign In for Pricing
View Details