Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat alpha Synuclein protein

This Rat alpha Synuclein protein spans the amino acid sequence from region 1-140aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Snca, Alpha-synuclein

UniProt

P37377

Expression Region

1-140aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal GST-taggedExpression Region: 1-140aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQMGKGEEGYPQEGILEDMPVDPSSEAYEMPSEEGYQDYEPEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OLFR179 Adenovirus (Mouse)
32961054 1.0 mL

OLFR179 Adenovirus (Mouse)

Sign In for Pricing
View Details
ACACA Recombinant Rabbit mAb
orb3184699-01 25 µL

ACACA Recombinant Rabbit mAb

Sign In for Pricing
View Details
ACACA Recombinant Rabbit mAb
orb3184699-02 50 µL

ACACA Recombinant Rabbit mAb

Sign In for Pricing
View Details
ACACA Recombinant Rabbit mAb
orb3184699-03 100 µL

ACACA Recombinant Rabbit mAb

Sign In for Pricing
View Details
KLC1 (NM_182923) Human Tagged Lenti ORF Clone
RC220210L4 10 µg

KLC1 (NM_182923) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Mouse DPT
MBS7622206-01 0.01 mg

Recombinant Mouse DPT

Sign In for Pricing
View Details