Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat alpha Synuclein protein

This Rat alpha Synuclein protein spans the amino acid sequence from region 1-140aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Snca, Alpha-synuclein

UniProt

P37377

Expression Region

1-140aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal GST-taggedExpression Region: 1-140aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQMGKGEEGYPQEGILEDMPVDPSSEAYEMPSEEGYQDYEPEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RN5S430 Adenovirus (Human)
40019051 1.0 mL

RN5S430 Adenovirus (Human)

Sign In for Pricing
View Details
ZHX1 Antibody
E38QA7709 100 µL

ZHX1 Antibody

Sign In for Pricing
View Details
TSLPR hFc Chimera, Human
Z05932-500 500 µg

TSLPR hFc Chimera, Human

Sign In for Pricing
View Details
TRAFD1 Rabbit Polyclonal Antibody
orb668479-01 30 µL

TRAFD1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TRAFD1 Rabbit Polyclonal Antibody
orb668479-02 50 μL

TRAFD1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TRAFD1 Rabbit Polyclonal Antibody
orb668479-03 100 µL

TRAFD1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details