Mouse S100A8 protein
This Mouse S100A8 protein spans the amino acid sequence from region 2-89aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Calgranulin-AChemotactic cytokine CP-10Leukocyte L1 complex light chain, Migration inhibitory factor-related protein 8 , MRP-8 , p8Pro-inflammatory S100 cytokine, S100 calcium-binding protein A8
UniProt
P27005
Expression Region
2-89aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Mus musculus (Mouse)
Field of Research
Cell Biology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
26.2 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 2-89aaSequence Info: Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
PSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15148762 1 Vial
Lentiviral mouse Col6a1 shRNA (UAS) - Lentiviral mouse Col6a1 shRNA (UAS, GFP) plasmid
Sign In for Pricing
View Details TRV-0042154-01 20 µL
Polyclonal Antibody to Platelet Factor 4 (PF4)
Sign In for Pricing
View Details TRV-0042154-02 100 µL
Polyclonal Antibody to Platelet Factor 4 (PF4)
Sign In for Pricing
View Details TRV-0042154-03 200 µL
Polyclonal Antibody to Platelet Factor 4 (PF4)
Sign In for Pricing
View Details