Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse S100A8 protein

This Mouse S100A8 protein spans the amino acid sequence from region 2-89aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Calgranulin-AChemotactic cytokine CP-10Leukocyte L1 complex light chain, Migration inhibitory factor-related protein 8 , MRP-8 , p8Pro-inflammatory S100 cytokine, S100 calcium-binding protein A8

UniProt

P27005

Expression Region

2-89aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 2-89aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCMV-MFAP4 (human) -3xFLAG-Neo
BZ54817 1 Vial

PCMV-MFAP4 (human) -3xFLAG-Neo

Sign In for Pricing
View Details
ACOT4 Antibody
DF3735-01 100 µL

ACOT4 Antibody

Sign In for Pricing
View Details
ACOT4 Antibody
DF3735-02 200 µL

ACOT4 Antibody

Sign In for Pricing
View Details
Lentiviral human UBLCP1 sgRNA gene knockout kit - Lentiviral human UBLCP1 sgRNA gene knockout kit (plasmid)
GTR15390047 1 Vial

Lentiviral human UBLCP1 sgRNA gene knockout kit - Lentiviral human UBLCP1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
GTPase IMAP family member 6 (GIMAP6) Mouse ELISA Kit
D8920 96 Tests

GTPase IMAP family member 6 (GIMAP6) Mouse ELISA Kit

Sign In for Pricing
View Details
GADL1 Protein Vector (Mouse) (pPB-C-His)
PV181018 500 ng

GADL1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details