Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse S100A8 protein

This Mouse S100A8 protein spans the amino acid sequence from region 2-89aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Calgranulin-AChemotactic cytokine CP-10Leukocyte L1 complex light chain, Migration inhibitory factor-related protein 8 , MRP-8 , p8Pro-inflammatory S100 cytokine, S100 calcium-binding protein A8

UniProt

P27005

Expression Region

2-89aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 2-89aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Arabidopsis thaliana Thionin-2.2 (THI2.2)
MBS1402476-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana Thionin-2.2 (THI2.2)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Thionin-2.2 (THI2.2)
MBS1402476-02 0.1 mg (E-Coli)

Recombinant Arabidopsis thaliana Thionin-2.2 (THI2.2)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Thionin-2.2 (THI2.2)
MBS1402476-03 0.02 mg (Yeast)

Recombinant Arabidopsis thaliana Thionin-2.2 (THI2.2)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Thionin-2.2 (THI2.2)
MBS1402476-04 0.1 mg (Yeast)

Recombinant Arabidopsis thaliana Thionin-2.2 (THI2.2)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Thionin-2.2 (THI2.2)
MBS1402476-05 0.02 mg (Baculovirus)

Recombinant Arabidopsis thaliana Thionin-2.2 (THI2.2)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Thionin-2.2 (THI2.2)
MBS1402476-06 1 mg (E-Coli)

Recombinant Arabidopsis thaliana Thionin-2.2 (THI2.2)

Sign In for Pricing
View Details