Human RS1 protein
This Human RS1 protein spans the amino acid sequence from region 24-224aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
X-linked juvenile retinoschisis protein
UniProt
O15537
Expression Region
24-224aa
Tag
N-terminal GST-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Cell Biology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
50.0 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Tag Info: N-terminal GST-taggedExpression Region: 24-224aaSequence Info: Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
STEDEGEDPWYQKACKCDCQGGPNALWSAGATSLDCIPECPYHKPLGFESGEVTPDQITCSNPEQYVGWYSSWTANKARLNSQGFGCAWLSKFQDSSQWLQIDLKEIKVISGILTQGRCDIDEWMTKYSVQYRTDERLNWIYYKDQTGNNRVFYGNSDRTSTVQNLLRPPIISRFIRLIPLGWHVRIAIRMELLECVSKCA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
NR-E10877-01 96 Tests
Human Phospho-ATM (S1981) ELISA Kit Intracellular
Sign In for Pricing
View Details NR-E10877-02 2x 96 Tests
Human Phospho-ATM (S1981) ELISA Kit Intracellular
Sign In for Pricing
View Details NR-E10877-03 4x 96 Tests
Human Phospho-ATM (S1981) ELISA Kit Intracellular
Sign In for Pricing
View Details 
M9931-25A 100 µg
MYRIP (SLAC2C, OTTHUMP00000209206, MGC130035, MGC130034, FLJ44025, synaptotagmin-like protein homologue lacking C2 domains-c, Slp homologue lacking C2 domains, rab effector MYRIP, DKFZp586F1018, exophilin 8, exophilin, SLAC2-C, MyRIP, myosin VIIA and Rab interacting protein)
Sign In for Pricing
View Details