Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RS1 protein

This Human RS1 protein spans the amino acid sequence from region 24-224aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

X-linked juvenile retinoschisis protein

UniProt

O15537

Expression Region

24-224aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 24-224aaSequence Info: Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

STEDEGEDPWYQKACKCDCQGGPNALWSAGATSLDCIPECPYHKPLGFESGEVTPDQITCSNPEQYVGWYSSWTANKARLNSQGFGCAWLSKFQDSSQWLQIDLKEIKVISGILTQGRCDIDEWMTKYSVQYRTDERLNWIYYKDQTGNNRVFYGNSDRTSTVQNLLRPPIISRFIRLIPLGWHVRIAIRMELLECVSKCA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANKRD16 Double Nickase Plasmid (h)
sc-412300-NIC 20 µg

ANKRD16 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
ANKRD26L1 Adenovirus (Human)
11970051 1.0 mL

ANKRD26L1 Adenovirus (Human)

Sign In for Pricing
View Details
Olr380 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV636516 1.0 µg DNA

Olr380 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Thymalfasin Impurity D-Ala4
RM-T251958-01 10 mg

Thymalfasin Impurity D-Ala4

Sign In for Pricing
View Details
Thymalfasin Impurity D-Ala4
RM-T251958-02 25 mg

Thymalfasin Impurity D-Ala4

Sign In for Pricing
View Details
Thymalfasin Impurity D-Ala4
RM-T251958-03 50 mg

Thymalfasin Impurity D-Ala4

Sign In for Pricing
View Details