Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RS1 protein

This Human RS1 protein spans the amino acid sequence from region 24-224aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

X-linked juvenile retinoschisis protein

UniProt

O15537

Expression Region

24-224aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 24-224aaSequence Info: Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

STEDEGEDPWYQKACKCDCQGGPNALWSAGATSLDCIPECPYHKPLGFESGEVTPDQITCSNPEQYVGWYSSWTANKARLNSQGFGCAWLSKFQDSSQWLQIDLKEIKVISGILTQGRCDIDEWMTKYSVQYRTDERLNWIYYKDQTGNNRVFYGNSDRTSTVQNLLRPPIISRFIRLIPLGWHVRIAIRMELLECVSKCA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fmoc- (S) -3-amino-3- (2-nitrophenyl) propionic acid
sc-294677B 1 g

Fmoc- (S) -3-amino-3- (2-nitrophenyl) propionic acid

Sign In for Pricing
View Details
Arylsulfatase E (F-4) PE
sc-393224 PE 200 µg/mL

Arylsulfatase E (F-4) PE

Sign In for Pricing
View Details
DNA polymerase subunit II Rabbit Polyclonal Antibody (APC-Cy7)
orb2531297 100 µL

DNA polymerase subunit II Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
Lbx1 (NM_001047108) Rat Tagged ORF Clone Lentiviral Particle
RR209686L3V 200 µL

Lbx1 (NM_001047108) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse Monoclonal Aldosterone Antibody (BGN/10/42110) [Janelia Fluor 646]
NB100-62313JF646 0.1 mL

Mouse Monoclonal Aldosterone Antibody (BGN/10/42110) [Janelia Fluor 646]

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Prolactin (PRL)
MBS2108019-01 0.1 mL

APC-Linked Polyclonal Antibody to Prolactin (PRL)

Sign In for Pricing
View Details