Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human KPNA1 protein

This Human KPNA1 protein spans the amino acid sequence from region 8-538aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Karyopherin subunit alpha-2RAG cohort protein 1SRP1-alpha

UniProt

P52294

Expression Region

8-538aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

63.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 8-538aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHEAQISNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGTEDEDSSIAPQVDLNQQQYIFQQCEAPMEGFQL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Endothelin 1
546595 200 µL

Endothelin 1

Sign In for Pricing
View Details
ARIH2 (C) Antibody, Rabbit Polyclonal
orb387202 100 µL

ARIH2 (C) Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
MED8 Rabbit Polyclonal Antibody (APC)
orb1002073 100 µL

MED8 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
PHKG1 Rabbit Polyclonal Antibody (PE)
orb2581474 100 µg

PHKG1 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Human Cancer/Testis Antigen 2 (CTAG2) ELISA Kit
MBS9302885-01 48 Well

Human Cancer/Testis Antigen 2 (CTAG2) ELISA Kit

Sign In for Pricing
View Details
Human Cancer/Testis Antigen 2 (CTAG2) ELISA Kit
MBS9302885-02 96 Well

Human Cancer/Testis Antigen 2 (CTAG2) ELISA Kit

Sign In for Pricing
View Details