Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IFNA14 protein

This Human IFNA14 protein spans the amino acid sequence from region 24-189aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interferon alpha-H , LeIF HInterferon lambda-2-H

UniProt

P01570

Expression Region

24-189aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal GST-taggedExpression Region: 24-189aaSequence Info: Full Length of BC000506

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CNLSQTHSLNNRRTLMLMAQMRRISPFSCLKDRHDFEFPQEEFDGNQFQKAQAISVLHEMMQQTFNLFSTKNSSAAWDETLLEKFYIELFQQMNDLEACVIQEVGVEETPLMNEDSILAVKKYFQRITLYLMEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(E,E)-Piperic Acid S-[2-(Acetylamino)ethyl] Ester
TRC-P481490-10MG 10 mg

(E,E)-Piperic Acid S-[2-(Acetylamino)ethyl] Ester

Sign In for Pricing
View Details
LHX4 (NM_033343) Human Over-expression Lysate
LC403244 20 µg

LHX4 (NM_033343) Human Over-expression Lysate

Sign In for Pricing
View Details
TIMP1 Polyclonal Antibody
E-AB-66160-01 60 µL

TIMP1 Polyclonal Antibody

Sign In for Pricing
View Details
TIMP1 Polyclonal Antibody
E-AB-66160-02 120 µL

TIMP1 Polyclonal Antibody

Sign In for Pricing
View Details
TIMP1 Polyclonal Antibody
E-AB-66160-03 200 µL

TIMP1 Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS805354 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details