Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IFNA14 protein

This Human IFNA14 protein spans the amino acid sequence from region 24-189aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interferon alpha-H , LeIF HInterferon lambda-2-H

UniProt

P01570

Expression Region

24-189aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal GST-taggedExpression Region: 24-189aaSequence Info: Full Length of BC000506

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CNLSQTHSLNNRRTLMLMAQMRRISPFSCLKDRHDFEFPQEEFDGNQFQKAQAISVLHEMMQQTFNLFSTKNSSAAWDETLLEKFYIELFQQMNDLEACVIQEVGVEETPLMNEDSILAVKKYFQRITLYLMEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken IgY, AlpHcAbs® Goat antibody (HRP)
HA710056 100 µg

Chicken IgY, AlpHcAbs® Goat antibody (HRP)

Sign In for Pricing
View Details
Serpinb12 Mouse Gene Knockout Kit (CRISPR)
KN515577 1 Kit

Serpinb12 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (rNX2/1523), CF594 conjugate, 0.1mg/mL
BNC942309-100 1x 100 µL

NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (rNX2/1523), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS700616 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Prohibitin (Mitochondrial Marker) (PHB/3225), CF594 conjugate, 0.1mg/mL
BNC943225-100 1x 100 µL

Prohibitin (Mitochondrial Marker) (PHB/3225), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BCL2-like 2 (CPTC-BCL2L2-2), CF568 conjugate, 0.1mg/mL
BNC682265-500 1x 500 µL

BCL2-like 2 (CPTC-BCL2L2-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details