Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse HAS2 protein

This Mouse HAS2 protein spans the amino acid sequence from region 67-374aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hyaluronate synthase 2Hyaluronic acid synthase 2 , HA synthase 2

UniProt

P70312

Expression Region

67-374aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 67-374aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EHRKMKKSLETPIKLNKTVALCIAAYQEDPDYLRKCLQSVKRLTYPGIKVVMVIDGNSDDDLYMMDIFSEVMGRDKSATYIWKNNFHEKGPGETEESHKESSQHVTQLVLSNKSICIMQKWGGKREVMYTAFRALGRSVDYVQVCDSDTMLDPASSVEMVKVLEEDPMVGGVGGDVQILNKYDSWISFLSSVRYWMAFNIERACQSYFGCVQCISGPLGMYRNSLLHEFVEDWYNQEFMGNQCSFGDDRHLTNRVLSLGYATKYTARSKCLTETPIEYLRWLNQQTRWSKSYFREWLYNAMWFHKHHL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ECM1 (h) -PR
sc-62255-PR 10 µM - 20 µL

ECM1 (h) -PR

Sign In for Pricing
View Details
Human GAPVD1 qPCR Primer Pair
QH37461S 200 Tests

Human GAPVD1 qPCR Primer Pair

Sign In for Pricing
View Details
GW182 (A-6) Alexa Fluor® 488
sc-374458 AF488 200 µg/mL

GW182 (A-6) Alexa Fluor® 488

Sign In for Pricing
View Details
Gm5803 (Hnrnpa1l2-ps2) (NM_001165971) Mouse Tagged ORF Clone Lentiviral Particle
MR214026L3V 200 µL

Gm5803 (Hnrnpa1l2-ps2) (NM_001165971) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
FNDC3A Lentiviral Activation Particles (m)
sc-435616-LAC 200 µL

FNDC3A Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Ern1, CT (Ern1, Ire1, Serine/threonine-protein kinase/endoribonuclease IRE1, Endoplasmic reticulum-to-nucleus signaling 1, Inositol-requiring protein 1, Ire1-alpha, Serine/threonine-protein kinase, Endoribonuclease)
MBS648235-01 0.2 mL

Ern1, CT (Ern1, Ire1, Serine/threonine-protein kinase/endoribonuclease IRE1, Endoplasmic reticulum-to-nucleus signaling 1, Inositol-requiring protein 1, Ire1-alpha, Serine/threonine-protein kinase, Endoribonuclease)

Sign In for Pricing
View Details