Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GPX1 protein

This Human GPX1 protein spans the amino acid sequence from region 1-203aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cellular glutathione peroxidase

UniProt

P07203

Expression Region

1-203aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 1-203aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLSGTTVRDYTQMNELQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGAGAHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEALLSQGPSCA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USPL1 Human Over-expression Lysate
orb1357488 100 µg

USPL1 Human Over-expression Lysate

Sign In for Pricing
View Details
CRTAP Rabbit Polyclonal Antibody
orb412278-01 30 µL

CRTAP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CRTAP Rabbit Polyclonal Antibody
orb412278-02 50 μL

CRTAP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CRTAP Rabbit Polyclonal Antibody
orb412278-03 100 µL

CRTAP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CRTAP Rabbit Polyclonal Antibody
orb412278-04 200 µL

CRTAP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
H-GTGGANIDPTFFLSR-OH
PP42733-01 1 mg

H-GTGGANIDPTFFLSR-OH

Sign In for Pricing
View Details