Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DHODH protein

This Human DHODH protein spans the amino acid sequence from region 31-395aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Dihydroorotate oxidase

UniProt

Q02127

Expression Region

31-395aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 31-395aaSequence Info: Cytoplasmic Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CymaxTM Human IL-8 ELISA Kit
LF-EK0262 1×96T

CymaxTM Human IL-8 ELISA Kit

Sign In for Pricing
View Details
MYLPF Antibody, FITC conjugated
CSB-PA856892HC01HU-01 50 µg

MYLPF Antibody, FITC conjugated

Sign In for Pricing
View Details
MYLPF Antibody, FITC conjugated
CSB-PA856892HC01HU-02 100 µg

MYLPF Antibody, FITC conjugated

Sign In for Pricing
View Details
C1orf21 (NM_030806) Human Over-expression Lysate
LC410701 20 µg

C1orf21 (NM_030806) Human Over-expression Lysate

Sign In for Pricing
View Details
Tris-Glycine SDS Running Buffer 10×
8015023 5 L

Tris-Glycine SDS Running Buffer 10×

Sign In for Pricing
View Details
GDF3 (Growth Differentiation Factor 3) (AP) discontinued
246536-AP 100 µL

GDF3 (Growth Differentiation Factor 3) (AP) discontinued

Sign In for Pricing
View Details