Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DHODH protein

This Human DHODH protein spans the amino acid sequence from region 31-395aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Dihydroorotate oxidase

UniProt

Q02127

Expression Region

31-395aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 31-395aaSequence Info: Cytoplasmic Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mst3, CT (Mammalian STE20-like Protein Kinase 3, MST-3, MST3B, Serine/threonine Kinase 24 (Ste20, Yeast Homolog), STE20 Homolog (yeast), STE20-like Kinase MST3, STK3, STK24) (MaxLight 490)
MBS6488649-01 0.1 mL

Mst3, CT (Mammalian STE20-like Protein Kinase 3, MST-3, MST3B, Serine/threonine Kinase 24 (Ste20, Yeast Homolog), STE20 Homolog (yeast), STE20-like Kinase MST3, STK3, STK24) (MaxLight 490)

Sign In for Pricing
View Details
Mst3, CT (Mammalian STE20-like Protein Kinase 3, MST-3, MST3B, Serine/threonine Kinase 24 (Ste20, Yeast Homolog), STE20 Homolog (yeast), STE20-like Kinase MST3, STK3, STK24) (MaxLight 490)
MBS6488649-02 5x 0.1 mL

Mst3, CT (Mammalian STE20-like Protein Kinase 3, MST-3, MST3B, Serine/threonine Kinase 24 (Ste20, Yeast Homolog), STE20 Homolog (yeast), STE20-like Kinase MST3, STK3, STK24) (MaxLight 490)

Sign In for Pricing
View Details
OGFRL1 Protein Vector (Mouse) (pPB-C-His)
PV207786 500 ng

OGFRL1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Anti-Claudin 2/CLDN2 Antibody Picoband®, iFluor647 Conjugate
A03033-2-iFluor647 100 µg

Anti-Claudin 2/CLDN2 Antibody Picoband®, iFluor647 Conjugate

Sign In for Pricing
View Details
Rabbit Anti-Human IgG+IgM+IgA Antibody (AcalephFluor405)
orb2990570-01 100 µL

Rabbit Anti-Human IgG+IgM+IgA Antibody (AcalephFluor405)

Sign In for Pricing
View Details
Rabbit Anti-Human IgG+IgM+IgA Antibody (AcalephFluor405)
orb2990570-02 500 µL

Rabbit Anti-Human IgG+IgM+IgA Antibody (AcalephFluor405)

Sign In for Pricing
View Details