Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fish CHRNA1 protein

This Fish CHRNA1 protein spans the amino acid sequence from region 25-234aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CHRNA1Acetylcholine receptor subunit alpha

UniProt

P02710

Expression Region

25-234aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Tetronarce californica (Pacific electric ray) (Torpedo californica)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 25-234aaSequence Info: Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SEHETRLVANLLENYNKVIRPVEHHTHFVDITVGLQLIQLISVDEVNQIVETNVRLRQQWIDVRLRWNPADYGGIKKIRLPSDDVWLPDLVLYNNADGDFAIVHMTKLLLDYTGKIMWTPPAIFKSYCEIIVTHFPFDQQNCTMKLGIWTYDGTKVSISPESDRPDLSTFMESGEWVMKDYRGWKHWVYYTCCPDTPYLDITYHFIMQRI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

cIAP1 Ligand-Linker Conjugates 15
MBS3843473-01 1 mg

cIAP1 Ligand-Linker Conjugates 15

Sign In for Pricing
View Details
cIAP1 Ligand-Linker Conjugates 15
MBS3843473-02 5 mg

cIAP1 Ligand-Linker Conjugates 15

Sign In for Pricing
View Details
cIAP1 Ligand-Linker Conjugates 15
MBS3843473-03 10 mg

cIAP1 Ligand-Linker Conjugates 15

Sign In for Pricing
View Details
cIAP1 Ligand-Linker Conjugates 15
MBS3843473-04 5x 10 mg

cIAP1 Ligand-Linker Conjugates 15

Sign In for Pricing
View Details
FGR (Gardner-Rasheed feline Sarcoma Viral (v-fgr) Oncogene Homolog, FLJ43153, MGC75096, SRC2, c-fgr, c-src2, p55c-fgr, p58c-fgr) (MaxLight 750) discontinued
246113-ML750 100 µL

FGR (Gardner-Rasheed feline Sarcoma Viral (v-fgr) Oncogene Homolog, FLJ43153, MGC75096, SRC2, c-fgr, c-src2, p55c-fgr, p58c-fgr) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Mouse Ndufaf7 qPCR Primer Pair
QM42194S 200 Tests

Mouse Ndufaf7 qPCR Primer Pair

Sign In for Pricing
View Details